PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400047412
Common NameLOC102587928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 345aa    MW: 37763.3 Da    PI: 6.2551
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400047412genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.51.6e-17236269134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C +C  tkTp+WR gp g+ktLCnaCG++y+k +
  PGSC0003DMP400047412 236 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKKGR 269
                           99******************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.5E-693324IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.49230266IPR000679Zinc finger, GATA-type
SMARTSM004013.8E-17230280IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.4E-15234269IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.42E-15234293No hitNo description
CDDcd002021.03E-13235282No hitNo description
PROSITE patternPS003440236261IPR000679Zinc finger, GATA-type
PfamPF003202.5E-15236270IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGSDFVDEID CSSFFDHMED LIEFSPENEC GGLDAVDCKD FPSIWNDPLP DSDPLFSGSY  60
SNSASDFSAE LSVPYEDIVQ LEWLSTFVED SFSCGGLTLG KEHCSVKKES SDSKFLTSSP  120
VSVLESSSSS SSSSTSSSGP GKTLPPLSPC TRGPQRARTK RPRPTTFNPR PVNHLMFPTS  180
VIPQQFVAPG VNSLESENFA ESPMKKKKKI KLSIPLAPIE TNQDNYQPAP QAVRKCLHCE  240
ITKTPQWRAG PMGPKTLCNA CGVRYKKGRL YPEYRPAASP TFVPSLHSNS HKKVLEMRSN  300
VFPEEDTDYK QAKPRQARPL IIGQAENNTT ASTTPTAQSD LNPK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159163KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350222.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_006350223.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLM1CLQ90.0M1CLQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000701340.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23452358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.26e-40GATA family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]